Anti BORCS5 pAb (ATL-HPA039509)

Atlas Antibodies

SKU:
ATL-HPA039509-25
  • Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: BLOC-1 related complex subunit 5
Gene Name: BORCS5
Alternative Gene Name: LOH12CR1, LOH1CR12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042992: 89%, ENSRNOG00000006505: 88%
Entrez Gene ID: 118426
Uniprot ID: Q969J3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL
Gene Sequence LSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL
Gene ID - Mouse ENSMUSG00000042992
Gene ID - Rat ENSRNOG00000006505
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BORCS5 pAb (ATL-HPA039509)
Datasheet Anti BORCS5 pAb (ATL-HPA039509) Datasheet (External Link)
Vendor Page Anti BORCS5 pAb (ATL-HPA039509) at Atlas Antibodies

Documents & Links for Anti BORCS5 pAb (ATL-HPA039509)
Datasheet Anti BORCS5 pAb (ATL-HPA039509) Datasheet (External Link)
Vendor Page Anti BORCS5 pAb (ATL-HPA039509)