Anti BORA pAb (ATL-HPA040866)

Atlas Antibodies

SKU:
ATL-HPA040866-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells, islet cells were moderately stained.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & nucleoli.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: bora, aurora kinase A activator
Gene Name: BORA
Alternative Gene Name: C13orf34, FLJ22624
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022070: 49%, ENSRNOG00000024798: 60%
Entrez Gene ID: 79866
Uniprot ID: Q6PGQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RKFTVHSPDASSGTNSNGITNPCIRSPYIDGCSPIKNWSPMRLQMYSGGTQYRTSVIQIPFTLETQGEDEEDKENIPSTDVSSPAMDAAGIHLRQF
Gene Sequence RKFTVHSPDASSGTNSNGITNPCIRSPYIDGCSPIKNWSPMRLQMYSGGTQYRTSVIQIPFTLETQGEDEEDKENIPSTDVSSPAMDAAGIHLRQF
Gene ID - Mouse ENSMUSG00000022070
Gene ID - Rat ENSRNOG00000024798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BORA pAb (ATL-HPA040866)
Datasheet Anti BORA pAb (ATL-HPA040866) Datasheet (External Link)
Vendor Page Anti BORA pAb (ATL-HPA040866) at Atlas Antibodies

Documents & Links for Anti BORA pAb (ATL-HPA040866)
Datasheet Anti BORA pAb (ATL-HPA040866) Datasheet (External Link)
Vendor Page Anti BORA pAb (ATL-HPA040866)