Anti BOP1 pAb (ATL-HPA047869)

Atlas Antibodies

Catalog No.: ATL-HPA047869-25

Protein Description: block of proliferation 1
Gene Name: BOP1
Alternative Gene Name: KIAA0124
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022557: 90%, ENSRNOG00000021773: 89%
Entrez Gene ID: 23246
Uniprot ID: Q14137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEP
• Gene Sequence: PLEWYDDFPHVGYDLDGRRIYKPLRTRDELDQFLDKMDDPDYWRTVQDPMTGRDLRLTDEQVALVRRLQSGQFGDVGFNPYEP
• Gene ID - Mouse: ENSMUSG00000022557
• Gene ID - Rat: ENSRNOG00000021773
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.