Anti BOLA3 pAb (ATL-HPA053162)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053162-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BOLA3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045160: 90%, ENSRNOG00000021866: 88%
Entrez Gene ID: 388962
Uniprot ID: Q53S33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVP |
Gene Sequence | GLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVP |
Gene ID - Mouse | ENSMUSG00000045160 |
Gene ID - Rat | ENSRNOG00000021866 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BOLA3 pAb (ATL-HPA053162) | |
Datasheet | Anti BOLA3 pAb (ATL-HPA053162) Datasheet (External Link) |
Vendor Page | Anti BOLA3 pAb (ATL-HPA053162) at Atlas Antibodies |
Documents & Links for Anti BOLA3 pAb (ATL-HPA053162) | |
Datasheet | Anti BOLA3 pAb (ATL-HPA053162) Datasheet (External Link) |
Vendor Page | Anti BOLA3 pAb (ATL-HPA053162) |