Anti BOLA3 pAb (ATL-HPA046393)

Atlas Antibodies

Catalog No.:
ATL-HPA046393-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: bolA family member 3
Gene Name: BOLA3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045160: 90%, ENSRNOG00000021866: 88%
Entrez Gene ID: 388962
Uniprot ID: Q53S33
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVP
Gene Sequence GLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVP
Gene ID - Mouse ENSMUSG00000045160
Gene ID - Rat ENSRNOG00000021866
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BOLA3 pAb (ATL-HPA046393)
Datasheet Anti BOLA3 pAb (ATL-HPA046393) Datasheet (External Link)
Vendor Page Anti BOLA3 pAb (ATL-HPA046393) at Atlas Antibodies

Documents & Links for Anti BOLA3 pAb (ATL-HPA046393)
Datasheet Anti BOLA3 pAb (ATL-HPA046393) Datasheet (External Link)
Vendor Page Anti BOLA3 pAb (ATL-HPA046393)