Anti BOLA2 pAb (ATL-HPA045380)

Atlas Antibodies

Catalog No.:
ATL-HPA045380-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: bolA family member 2
Gene Name: BOLA2
Alternative Gene Name: BOLA2A, My016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019254: 28%, ENSRNOG00000014275: 33%
Entrez Gene ID: 552900
Uniprot ID: Q9H3K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRD
Gene Sequence LEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRD
Gene ID - Mouse ENSMUSG00000019254
Gene ID - Rat ENSRNOG00000014275
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BOLA2 pAb (ATL-HPA045380)
Datasheet Anti BOLA2 pAb (ATL-HPA045380) Datasheet (External Link)
Vendor Page Anti BOLA2 pAb (ATL-HPA045380) at Atlas Antibodies

Documents & Links for Anti BOLA2 pAb (ATL-HPA045380)
Datasheet Anti BOLA2 pAb (ATL-HPA045380) Datasheet (External Link)
Vendor Page Anti BOLA2 pAb (ATL-HPA045380)