Anti BOLA2 pAb (ATL-HPA045380)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045380-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BOLA2
Alternative Gene Name: BOLA2A, My016
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019254: 28%, ENSRNOG00000014275: 33%
Entrez Gene ID: 552900
Uniprot ID: Q9H3K6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRD |
| Gene Sequence | LEGGSTALTYALVRAEVSFPAEVAPVRQQGSVAGARAGVVSLLGCRSSWTAAMELSAEYLREKLQRD |
| Gene ID - Mouse | ENSMUSG00000019254 |
| Gene ID - Rat | ENSRNOG00000014275 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BOLA2 pAb (ATL-HPA045380) | |
| Datasheet | Anti BOLA2 pAb (ATL-HPA045380) Datasheet (External Link) |
| Vendor Page | Anti BOLA2 pAb (ATL-HPA045380) at Atlas Antibodies |
| Documents & Links for Anti BOLA2 pAb (ATL-HPA045380) | |
| Datasheet | Anti BOLA2 pAb (ATL-HPA045380) Datasheet (External Link) |
| Vendor Page | Anti BOLA2 pAb (ATL-HPA045380) |