Anti BOD1L1 pAb (ATL-HPA036943)

Atlas Antibodies

Catalog No.:
ATL-HPA036943-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: biorientation of chromosomes in cell division 1-like 1
Gene Name: BOD1L1
Alternative Gene Name: BOD1L, FAM44A, FLJ33215, KIAA1327
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061755: 79%, ENSRNOG00000050437: 84%
Entrez Gene ID: 259282
Uniprot ID: Q8NFC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDSMEEGEITSDDEEKNKQNKTKTQTSDSSEGKTKSVRHAYVHKPYLYSKYYSDSDDELTVEQRRQSIGILWF
Gene Sequence SDSMEEGEITSDDEEKNKQNKTKTQTSDSSEGKTKSVRHAYVHKPYLYSKYYSDSDDELTVEQRRQSIGILWF
Gene ID - Mouse ENSMUSG00000061755
Gene ID - Rat ENSRNOG00000050437
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BOD1L1 pAb (ATL-HPA036943)
Datasheet Anti BOD1L1 pAb (ATL-HPA036943) Datasheet (External Link)
Vendor Page Anti BOD1L1 pAb (ATL-HPA036943) at Atlas Antibodies

Documents & Links for Anti BOD1L1 pAb (ATL-HPA036943)
Datasheet Anti BOD1L1 pAb (ATL-HPA036943) Datasheet (External Link)
Vendor Page Anti BOD1L1 pAb (ATL-HPA036943)