Anti BOD1L1 pAb (ATL-HPA036943)

Atlas Antibodies

Catalog No.: ATL-HPA036943-25

Protein Description: biorientation of chromosomes in cell division 1-like 1
Gene Name: BOD1L1
Alternative Gene Name: BOD1L, FAM44A, FLJ33215, KIAA1327
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061755: 79%, ENSRNOG00000050437: 84%
Entrez Gene ID: 259282
Uniprot ID: Q8NFC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SDSMEEGEITSDDEEKNKQNKTKTQTSDSSEGKTKSVRHAYVHKPYLYSKYYSDSDDELTVEQRRQSIGILWF
• Gene Sequence: SDSMEEGEITSDDEEKNKQNKTKTQTSDSSEGKTKSVRHAYVHKPYLYSKYYSDSDDELTVEQRRQSIGILWF
• Gene ID - Mouse: ENSMUSG00000061755
• Gene ID - Rat: ENSRNOG00000050437
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.