Anti BOC pAb (ATL-HPA061787)

Atlas Antibodies

SKU:
ATL-HPA061787-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: BOC cell adhesion associated, oncogene regulated
Gene Name: BOC
Alternative Gene Name: CDON2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022687: 56%, ENSRNOG00000002041: 54%
Entrez Gene ID: 91653
Uniprot ID: Q9BWV1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSITPRLWQDAELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSS
Gene Sequence PSITPRLWQDAELATGTPPVSPSKLGNPEQMLRGQPALPRPPTSVGPASPQCPGEKGQGAPAEAPIILSS
Gene ID - Mouse ENSMUSG00000022687
Gene ID - Rat ENSRNOG00000002041
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BOC pAb (ATL-HPA061787)
Datasheet Anti BOC pAb (ATL-HPA061787) Datasheet (External Link)
Vendor Page Anti BOC pAb (ATL-HPA061787) at Atlas Antibodies

Documents & Links for Anti BOC pAb (ATL-HPA061787)
Datasheet Anti BOC pAb (ATL-HPA061787) Datasheet (External Link)
Vendor Page Anti BOC pAb (ATL-HPA061787)