Anti BNIP3L pAb (ATL-HPA015652 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA015652-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $395.00
    
         
                            Gene Name: BNIP3L
Alternative Gene Name: BNIP3a, Nix
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022051: 98%, ENSRNOG00000009820: 96%
Entrez Gene ID: 665
Uniprot ID: O60238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK | 
| Gene Sequence | SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK | 
| Gene ID - Mouse | ENSMUSG00000022051 | 
| Gene ID - Rat | ENSRNOG00000009820 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti BNIP3L pAb (ATL-HPA015652 w/enhanced validation) | |
| Datasheet | Anti BNIP3L pAb (ATL-HPA015652 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti BNIP3L pAb (ATL-HPA015652 w/enhanced validation) at Atlas Antibodies | 
| Documents & Links for Anti BNIP3L pAb (ATL-HPA015652 w/enhanced validation) | |
| Datasheet | Anti BNIP3L pAb (ATL-HPA015652 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti BNIP3L pAb (ATL-HPA015652 w/enhanced validation) | 
| Citations for Anti BNIP3L pAb (ATL-HPA015652 w/enhanced validation) – 3 Found | 
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed | 
| Li, Wen; Zhang, Xingli; Zhuang, Haixia; Chen, He-Ge; Chen, Yinqin; Tian, Weili; Wu, Wenxian; Li, Ying; Wang, Sijie; Zhang, Liangqing; Chen, Yusen; Li, Longxuan; Zhao, Bin; Sui, Senfang; Hu, Zhe; Feng, Du. MicroRNA-137 is a novel hypoxia-responsive microRNA that inhibits mitophagy via regulation of two mitophagy receptors FUNDC1 and NIX. The Journal Of Biological Chemistry. 2014;289(15):10691-10701. PubMed | 
| Simpson, Cory L; Tokito, Mariko K; Uppala, Ranjitha; Sarkar, Mrinal K; Gudjonsson, Johann E; Holzbaur, Erika L F. NIX initiates mitochondrial fragmentation via DRP1 to drive epidermal differentiation. Cell Reports. 2021;34(5):108689. PubMed |