Anti BNIP3L pAb (ATL-HPA015652 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA015652-25

• 
• 

Protein Description: BCL2/adenovirus E1B 19kDa interacting protein 3-like
Gene Name: BNIP3L
Alternative Gene Name: BNIP3a, Nix
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022051: 98%, ENSRNOG00000009820: 96%
Entrez Gene ID: 665
Uniprot ID: O60238
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
• Gene Sequence: SNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKEVEALKKSADWVSDWSSRPENIPPKEFHFRHPKRSVSLSMRKSGAMK
• Gene ID - Mouse: ENSMUSG00000022051
• Gene ID - Rat: ENSRNOG00000009820
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BNIP3L pAb (ATL-HPA015652 w/enhanced validation) – 3 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Li, Wen; Zhang, Xingli; Zhuang, Haixia; Chen, He-Ge; Chen, Yinqin; Tian, Weili; Wu, Wenxian; Li, Ying; Wang, Sijie; Zhang, Liangqing; Chen, Yusen; Li, Longxuan; Zhao, Bin; Sui, Senfang; Hu, Zhe; Feng, Du. MicroRNA-137 is a novel hypoxia-responsive microRNA that inhibits mitophagy via regulation of two mitophagy receptors FUNDC1 and NIX. The Journal Of Biological Chemistry. 2014;289(15):10691-10701. 

Simpson, Cory L; Tokito, Mariko K; Uppala, Ranjitha; Sarkar, Mrinal K; Gudjonsson, Johann E; Holzbaur, Erika L F. NIX initiates mitochondrial fragmentation via DRP1 to drive epidermal differentiation. Cell Reports. 2021;34(5):108689.