Anti BNIP3 pAb (ATL-HPA003015)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003015-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: BNIP3
Alternative Gene Name: Nip3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078566: 89%, ENSRNOG00000017243: 89%
Entrez Gene ID: 664
Uniprot ID: Q12983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKG |
| Gene Sequence | MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKG |
| Gene ID - Mouse | ENSMUSG00000078566 |
| Gene ID - Rat | ENSRNOG00000017243 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BNIP3 pAb (ATL-HPA003015) | |
| Datasheet | Anti BNIP3 pAb (ATL-HPA003015) Datasheet (External Link) |
| Vendor Page | Anti BNIP3 pAb (ATL-HPA003015) at Atlas Antibodies |
| Documents & Links for Anti BNIP3 pAb (ATL-HPA003015) | |
| Datasheet | Anti BNIP3 pAb (ATL-HPA003015) Datasheet (External Link) |
| Vendor Page | Anti BNIP3 pAb (ATL-HPA003015) |
| Citations for Anti BNIP3 pAb (ATL-HPA003015) – 5 Found |
| Chourasia, Aparajita H; Tracy, Kristin; Frankenberger, Casey; Boland, Michelle L; Sharifi, Marina N; Drake, Lauren E; Sachleben, Joseph R; Asara, John M; Locasale, Jason W; Karczmar, Gregory S; Macleod, Kay F. Mitophagy defects arising from BNip3 loss promote mammary tumor progression to metastasis. Embo Reports. 2015;16(9):1145-63. PubMed |
| Springer, Maya Z; Poole, Logan P; Drake, Lauren E; Bock-Hughes, Althea; Boland, Michelle L; Smith, Alexandra G; Hart, John; Chourasia, Aparajita H; Liu, Ivan; Bozek, Grazyna; Macleod, Kay F. BNIP3-dependent mitophagy promotes cytosolic localization of LC3B and metabolic homeostasis in the liver. Autophagy. 2021;17(11):3530-3546. PubMed |
| Vara-Pérez, Mónica; Rossi, Matteo; Van den Haute, Chris; Maes, Hannelore; Sassano, Maria Livia; Venkataramani, Vivek; Michalke, Bernhard; Romano, Erminia; Rillaerts, Kristine; Garg, Abhishek D; Schepkens, Corentin; Bosisio, Francesca M; Wouters, Jasper; Oliveira, Ana Isabel; Vangheluwe, Peter; Annaert, Wim; Swinnen, Johannes V; Colet, Jean Marie; van den Oord, Joost J; Fendt, Sarah-Maria; Mazzone, Massimiliano; Agostinis, Patrizia. BNIP3 promotes HIF-1α-driven melanoma growth by curbing intracellular iron homeostasis. The Embo Journal. 2021;40(10):e106214. PubMed |
| Thomas, Luke W; Esposito, Cinzia; Morgan, Rachel E; Price, Stacey; Young, Jamie; Williams, Steven P; Maddalena, Lucas A; McDermott, Ultan; Ashcroft, Margaret. Genome-wide CRISPR/Cas9 deletion screen defines mitochondrial gene essentiality and identifies routes for tumour cell viability in hypoxia. Communications Biology. 2021;4(1):615. PubMed |
| Berardi, Damian E; Bock-Hughes, Althea; Terry, Alexander R; Drake, Lauren E; Bozek, Grazyna; Macleod, Kay F. Lipid droplet turnover at the lysosome inhibits growth of hepatocellular carcinoma in a BNIP3-dependent manner. Science Advances. 2022;8(41):eabo2510. PubMed |