Anti BNIP3 pAb (ATL-HPA003015)

Atlas Antibodies

Catalog No.:
ATL-HPA003015-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: BCL2/adenovirus E1B 19kDa interacting protein 3
Gene Name: BNIP3
Alternative Gene Name: Nip3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078566: 89%, ENSRNOG00000017243: 89%
Entrez Gene ID: 664
Uniprot ID: Q12983
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKG
Gene Sequence MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKG
Gene ID - Mouse ENSMUSG00000078566
Gene ID - Rat ENSRNOG00000017243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BNIP3 pAb (ATL-HPA003015)
Datasheet Anti BNIP3 pAb (ATL-HPA003015) Datasheet (External Link)
Vendor Page Anti BNIP3 pAb (ATL-HPA003015) at Atlas Antibodies

Documents & Links for Anti BNIP3 pAb (ATL-HPA003015)
Datasheet Anti BNIP3 pAb (ATL-HPA003015) Datasheet (External Link)
Vendor Page Anti BNIP3 pAb (ATL-HPA003015)
Citations for Anti BNIP3 pAb (ATL-HPA003015) – 5 Found
Chourasia, Aparajita H; Tracy, Kristin; Frankenberger, Casey; Boland, Michelle L; Sharifi, Marina N; Drake, Lauren E; Sachleben, Joseph R; Asara, John M; Locasale, Jason W; Karczmar, Gregory S; Macleod, Kay F. Mitophagy defects arising from BNip3 loss promote mammary tumor progression to metastasis. Embo Reports. 2015;16(9):1145-63.  PubMed
Springer, Maya Z; Poole, Logan P; Drake, Lauren E; Bock-Hughes, Althea; Boland, Michelle L; Smith, Alexandra G; Hart, John; Chourasia, Aparajita H; Liu, Ivan; Bozek, Grazyna; Macleod, Kay F. BNIP3-dependent mitophagy promotes cytosolic localization of LC3B and metabolic homeostasis in the liver. Autophagy. 2021;17(11):3530-3546.  PubMed
Vara-Pérez, Mónica; Rossi, Matteo; Van den Haute, Chris; Maes, Hannelore; Sassano, Maria Livia; Venkataramani, Vivek; Michalke, Bernhard; Romano, Erminia; Rillaerts, Kristine; Garg, Abhishek D; Schepkens, Corentin; Bosisio, Francesca M; Wouters, Jasper; Oliveira, Ana Isabel; Vangheluwe, Peter; Annaert, Wim; Swinnen, Johannes V; Colet, Jean Marie; van den Oord, Joost J; Fendt, Sarah-Maria; Mazzone, Massimiliano; Agostinis, Patrizia. BNIP3 promotes HIF-1α-driven melanoma growth by curbing intracellular iron homeostasis. The Embo Journal. 2021;40(10):e106214.  PubMed
Thomas, Luke W; Esposito, Cinzia; Morgan, Rachel E; Price, Stacey; Young, Jamie; Williams, Steven P; Maddalena, Lucas A; McDermott, Ultan; Ashcroft, Margaret. Genome-wide CRISPR/Cas9 deletion screen defines mitochondrial gene essentiality and identifies routes for tumour cell viability in hypoxia. Communications Biology. 2021;4(1):615.  PubMed
Berardi, Damian E; Bock-Hughes, Althea; Terry, Alexander R; Drake, Lauren E; Bozek, Grazyna; Macleod, Kay F. Lipid droplet turnover at the lysosome inhibits growth of hepatocellular carcinoma in a BNIP3-dependent manner. Science Advances. 2022;8(41):eabo2510.  PubMed