Anti BNIP2 pAb (ATL-HPA026843)

Atlas Antibodies

Catalog No.: ATL-HPA026843-25

Protein Description: BCL2/adenovirus E1B 19kDa interacting protein 2
Gene Name: BNIP2
Alternative Gene Name: BNIP-2, Nip2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011958: 88%, ENSRNOG00000056024: 88%
Entrez Gene ID: 663
Uniprot ID: Q12982
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRV
• Gene Sequence: VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRV
• Gene ID - Mouse: ENSMUSG00000011958
• Gene ID - Rat: ENSRNOG00000056024
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BNIP2 pAb (ATL-HPA026843) – 1 Found

Pan, Meng; Chew, Ti Weng; Wong, Darren Chen Pei; Xiao, Jingwei; Ong, Hui Ting; Chin, Jasmine Fei Li; Low, Boon Chuan. BNIP-2 retards breast cancer cell migration by coupling microtubule-mediated GEF-H1 and RhoA activation. Science Advances. 2020;6(31):eaaz1534.