Anti BNIP1 pAb (ATL-HPA008009)

Atlas Antibodies

Catalog No.:
ATL-HPA008009-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: BCL2/adenovirus E1B 19kDa interacting protein 1
Gene Name: BNIP1
Alternative Gene Name: Nip1, SEC20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024191: 92%, ENSRNOG00000020753: 95%
Entrez Gene ID: 662
Uniprot ID: Q12981
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQE
Gene Sequence APQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQE
Gene ID - Mouse ENSMUSG00000024191
Gene ID - Rat ENSRNOG00000020753
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BNIP1 pAb (ATL-HPA008009)
Datasheet Anti BNIP1 pAb (ATL-HPA008009) Datasheet (External Link)
Vendor Page Anti BNIP1 pAb (ATL-HPA008009) at Atlas Antibodies

Documents & Links for Anti BNIP1 pAb (ATL-HPA008009)
Datasheet Anti BNIP1 pAb (ATL-HPA008009) Datasheet (External Link)
Vendor Page Anti BNIP1 pAb (ATL-HPA008009)