Anti BNC2 pAb (ATL-HPA059419)

Atlas Antibodies

Catalog No.:
ATL-HPA059419-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: basonuclin 2
Gene Name: BNC2
Alternative Gene Name: BSN2, FLJ20043
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028487: 98%, ENSRNOG00000006553: 97%
Entrez Gene ID: 54796
Uniprot ID: Q6ZN30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STQNEYNESSESEVSPTPYKNDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLTKTEHPKSSFRIHRMRRMGSASRKGRVFCNA
Gene Sequence STQNEYNESSESEVSPTPYKNDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLTKTEHPKSSFRIHRMRRMGSASRKGRVFCNA
Gene ID - Mouse ENSMUSG00000028487
Gene ID - Rat ENSRNOG00000006553
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BNC2 pAb (ATL-HPA059419)
Datasheet Anti BNC2 pAb (ATL-HPA059419) Datasheet (External Link)
Vendor Page Anti BNC2 pAb (ATL-HPA059419) at Atlas Antibodies

Documents & Links for Anti BNC2 pAb (ATL-HPA059419)
Datasheet Anti BNC2 pAb (ATL-HPA059419) Datasheet (External Link)
Vendor Page Anti BNC2 pAb (ATL-HPA059419)