Anti BNC1 pAb (ATL-HPA077428)
Atlas Antibodies
- SKU:
- ATL-HPA077428-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BNC1
Alternative Gene Name: BNC, HsT19447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025105: 70%, ENSRNOG00000019770: 71%
Entrez Gene ID: 646
Uniprot ID: Q01954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EKEAVEIANEKRHNLSSDEDMPLQVVSEDEQEACSPQSHRVSEEQHVQSGGLGKPFPEGERPCHRESVIESSG |
Gene Sequence | EKEAVEIANEKRHNLSSDEDMPLQVVSEDEQEACSPQSHRVSEEQHVQSGGLGKPFPEGERPCHRESVIESSG |
Gene ID - Mouse | ENSMUSG00000025105 |
Gene ID - Rat | ENSRNOG00000019770 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BNC1 pAb (ATL-HPA077428) | |
Datasheet | Anti BNC1 pAb (ATL-HPA077428) Datasheet (External Link) |
Vendor Page | Anti BNC1 pAb (ATL-HPA077428) at Atlas Antibodies |
Documents & Links for Anti BNC1 pAb (ATL-HPA077428) | |
Datasheet | Anti BNC1 pAb (ATL-HPA077428) Datasheet (External Link) |
Vendor Page | Anti BNC1 pAb (ATL-HPA077428) |