Anti BNC1 pAb (ATL-HPA066947)

Atlas Antibodies

Catalog No.:
ATL-HPA066947-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: basonuclin 1
Gene Name: BNC1
Alternative Gene Name: BNC, HsT19447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025105: 79%, ENSRNOG00000019770: 77%
Entrez Gene ID: 646
Uniprot ID: Q01954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REVEDGGHEHYFTPGMEPQVPFSDYMELQQRLLAGGLFSALSNRGMAFPCLEDSKELEHVGQHALARQIEENRFQCD
Gene Sequence REVEDGGHEHYFTPGMEPQVPFSDYMELQQRLLAGGLFSALSNRGMAFPCLEDSKELEHVGQHALARQIEENRFQCD
Gene ID - Mouse ENSMUSG00000025105
Gene ID - Rat ENSRNOG00000019770
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BNC1 pAb (ATL-HPA066947)
Datasheet Anti BNC1 pAb (ATL-HPA066947) Datasheet (External Link)
Vendor Page Anti BNC1 pAb (ATL-HPA066947) at Atlas Antibodies

Documents & Links for Anti BNC1 pAb (ATL-HPA066947)
Datasheet Anti BNC1 pAb (ATL-HPA066947) Datasheet (External Link)
Vendor Page Anti BNC1 pAb (ATL-HPA066947)