Anti BNC1 pAb (ATL-HPA063183)

Atlas Antibodies

Catalog No.: ATL-HPA063183-25

Protein Description: basonuclin 1
Gene Name: BNC1
Alternative Gene Name: BNC, HsT19447
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025105: 91%, ENSRNOG00000019770: 91%
Entrez Gene ID: 646
Uniprot ID: Q01954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSQEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSASLESYNSGPLSEGTILDLSTTSSMKS
• Gene Sequence: LSQEALESSEDHFRAAYLLKDVAKEAYQDVAFTQQASQTSVIFKGTSRMGSLVYPITQVHSASLESYNSGPLSEGTILDLSTTSSMKS
• Gene ID - Mouse: ENSMUSG00000025105
• Gene ID - Rat: ENSRNOG00000019770
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BNC1 pAb (ATL-HPA063183) – 1 Found

Gambardella, Laure; McManus, Sophie A; Moignard, Victoria; Sebukhan, Derya; Delaune, Agathe; Andrews, Simon; Bernard, William G; Morrison, Maura A; Riley, Paul R; Göttgens, Berthold; Gambardella Le Novère, Nicolas; Sinha, Sanjay. BNC1 regulates cell heterogeneity in human pluripotent stem cell-derived epicardium. Development (Cambridge, England). 2019;146(24)