Anti BMS1 pAb (ATL-HPA043081)

Atlas Antibodies

Catalog No.:
ATL-HPA043081-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: BMS1 ribosome biogenesis factor
Gene Name: BMS1
Alternative Gene Name: BMS1L, KIAA0187
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030138: 91%, ENSRNOG00000006576: 91%
Entrez Gene ID: 9790
Uniprot ID: Q14692
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELGGLFRVNQPDRECKHKADSLDCSRFLVEAPHDWDLEEVMNSIRDCFVTGKWEDDKDAAKVLAEDEELYGDFEDLETGDVHKGKSGPNTQNEDI
Gene Sequence ELGGLFRVNQPDRECKHKADSLDCSRFLVEAPHDWDLEEVMNSIRDCFVTGKWEDDKDAAKVLAEDEELYGDFEDLETGDVHKGKSGPNTQNEDI
Gene ID - Mouse ENSMUSG00000030138
Gene ID - Rat ENSRNOG00000006576
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BMS1 pAb (ATL-HPA043081)
Datasheet Anti BMS1 pAb (ATL-HPA043081) Datasheet (External Link)
Vendor Page Anti BMS1 pAb (ATL-HPA043081) at Atlas Antibodies

Documents & Links for Anti BMS1 pAb (ATL-HPA043081)
Datasheet Anti BMS1 pAb (ATL-HPA043081) Datasheet (External Link)
Vendor Page Anti BMS1 pAb (ATL-HPA043081)