Anti BMPR2 pAb (ATL-HPA049014)

Atlas Antibodies

Catalog No.:
ATL-HPA049014-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: bone morphogenetic protein receptor, type II (serine/threonine kinase)
Gene Name: BMPR2
Alternative Gene Name: BMPR-II, BMPR3, BRK-3, PPH1, T-ALK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067336: 90%, ENSRNOG00000022196: 90%
Entrez Gene ID: 659
Uniprot ID: Q13873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE
Gene Sequence QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE
Gene ID - Mouse ENSMUSG00000067336
Gene ID - Rat ENSRNOG00000022196
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BMPR2 pAb (ATL-HPA049014)
Datasheet Anti BMPR2 pAb (ATL-HPA049014) Datasheet (External Link)
Vendor Page Anti BMPR2 pAb (ATL-HPA049014) at Atlas Antibodies

Documents & Links for Anti BMPR2 pAb (ATL-HPA049014)
Datasheet Anti BMPR2 pAb (ATL-HPA049014) Datasheet (External Link)
Vendor Page Anti BMPR2 pAb (ATL-HPA049014)
Citations for Anti BMPR2 pAb (ATL-HPA049014) – 2 Found
O'Neill, Hannah L; Cassidy, Amy P; Harris, Olivia B; Cassidy, John W. BMP2/BMPR1A is linked to tumour progression in dedifferentiated liposarcomas. Peerj. 4( 27114889):e1957.  PubMed
Vora, Mehul; Mondal, Arindam; Jia, Dongxuan; Gaddipati, Pranya; Akel, Moumen; Gilleran, John; Roberge, Jacques; Rongo, Christopher; Langenfeld, John. Bone morphogenetic protein signaling regulation of AMPK and PI3K in lung cancer cells and C. elegans. Cell & Bioscience. 2022;12(1):76.  PubMed