Anti BMPR2 pAb (ATL-HPA049014)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049014-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: BMPR2
Alternative Gene Name: BMPR-II, BMPR3, BRK-3, PPH1, T-ALK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067336: 90%, ENSRNOG00000022196: 90%
Entrez Gene ID: 659
Uniprot ID: Q13873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE |
Gene Sequence | QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE |
Gene ID - Mouse | ENSMUSG00000067336 |
Gene ID - Rat | ENSRNOG00000022196 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BMPR2 pAb (ATL-HPA049014) | |
Datasheet | Anti BMPR2 pAb (ATL-HPA049014) Datasheet (External Link) |
Vendor Page | Anti BMPR2 pAb (ATL-HPA049014) at Atlas Antibodies |
Documents & Links for Anti BMPR2 pAb (ATL-HPA049014) | |
Datasheet | Anti BMPR2 pAb (ATL-HPA049014) Datasheet (External Link) |
Vendor Page | Anti BMPR2 pAb (ATL-HPA049014) |
Citations for Anti BMPR2 pAb (ATL-HPA049014) – 2 Found |
O'Neill, Hannah L; Cassidy, Amy P; Harris, Olivia B; Cassidy, John W. BMP2/BMPR1A is linked to tumour progression in dedifferentiated liposarcomas. Peerj. 4( 27114889):e1957. PubMed |
Vora, Mehul; Mondal, Arindam; Jia, Dongxuan; Gaddipati, Pranya; Akel, Moumen; Gilleran, John; Roberge, Jacques; Rongo, Christopher; Langenfeld, John. Bone morphogenetic protein signaling regulation of AMPK and PI3K in lung cancer cells and C. elegans. Cell & Bioscience. 2022;12(1):76. PubMed |