Anti BMPR2 pAb (ATL-HPA049014)

Atlas Antibodies

Catalog No.: ATL-HPA049014-25

Protein Description: bone morphogenetic protein receptor, type II (serine/threonine kinase)
Gene Name: BMPR2
Alternative Gene Name: BMPR-II, BMPR3, BRK-3, PPH1, T-ALK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067336: 90%, ENSRNOG00000022196: 90%
Entrez Gene ID: 659
Uniprot ID: Q13873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE
• Gene Sequence: QACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVTHRAQEMLQNQFIGE
• Gene ID - Mouse: ENSMUSG00000067336
• Gene ID - Rat: ENSRNOG00000022196
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BMPR2 pAb (ATL-HPA049014) – 2 Found

O'Neill, Hannah L; Cassidy, Amy P; Harris, Olivia B; Cassidy, John W. BMP2/BMPR1A is linked to tumour progression in dedifferentiated liposarcomas. Peerj. 4( 27114889):e1957. 

Vora, Mehul; Mondal, Arindam; Jia, Dongxuan; Gaddipati, Pranya; Akel, Moumen; Gilleran, John; Roberge, Jacques; Rongo, Christopher; Langenfeld, John. Bone morphogenetic protein signaling regulation of AMPK and PI3K in lung cancer cells and C. elegans. Cell & Bioscience. 2022;12(1):76.