Anti BMPR2 pAb (ATL-HPA017385)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017385-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: BMPR2
Alternative Gene Name: BMPR-II, BMPR3, BRK-3, PPH1, T-ALK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067336: 100%, ENSRNOG00000022196: 99%
Entrez Gene ID: 659
Uniprot ID: Q13873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSF |
| Gene Sequence | PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSF |
| Gene ID - Mouse | ENSMUSG00000067336 |
| Gene ID - Rat | ENSRNOG00000022196 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BMPR2 pAb (ATL-HPA017385) | |
| Datasheet | Anti BMPR2 pAb (ATL-HPA017385) Datasheet (External Link) |
| Vendor Page | Anti BMPR2 pAb (ATL-HPA017385) at Atlas Antibodies |
| Documents & Links for Anti BMPR2 pAb (ATL-HPA017385) | |
| Datasheet | Anti BMPR2 pAb (ATL-HPA017385) Datasheet (External Link) |
| Vendor Page | Anti BMPR2 pAb (ATL-HPA017385) |