Anti BMPR2 pAb (ATL-HPA017385)

Atlas Antibodies

SKU:
ATL-HPA017385-25
  • Immunohistochemical staining of human spleen shows distinct cytoplasmic positivity in cells in red pulp.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: bone morphogenetic protein receptor, type II (serine/threonine kinase)
Gene Name: BMPR2
Alternative Gene Name: BMPR-II, BMPR3, BRK-3, PPH1, T-ALK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067336: 100%, ENSRNOG00000022196: 99%
Entrez Gene ID: 659
Uniprot ID: Q13873
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSF
Gene Sequence PYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSF
Gene ID - Mouse ENSMUSG00000067336
Gene ID - Rat ENSRNOG00000022196
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BMPR2 pAb (ATL-HPA017385)
Datasheet Anti BMPR2 pAb (ATL-HPA017385) Datasheet (External Link)
Vendor Page Anti BMPR2 pAb (ATL-HPA017385) at Atlas Antibodies

Documents & Links for Anti BMPR2 pAb (ATL-HPA017385)
Datasheet Anti BMPR2 pAb (ATL-HPA017385) Datasheet (External Link)
Vendor Page Anti BMPR2 pAb (ATL-HPA017385)