Anti BMP7 pAb (ATL-HPA057757)

Atlas Antibodies

Catalog No.:
ATL-HPA057757-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: bone morphogenetic protein 7
Gene Name: BMP7
Alternative Gene Name: OP-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008999: 95%, ENSRNOG00000053384: 95%
Entrez Gene ID: 655
Uniprot ID: P18075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKH
Gene Sequence AFFKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKH
Gene ID - Mouse ENSMUSG00000008999
Gene ID - Rat ENSRNOG00000053384
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BMP7 pAb (ATL-HPA057757)
Datasheet Anti BMP7 pAb (ATL-HPA057757) Datasheet (External Link)
Vendor Page Anti BMP7 pAb (ATL-HPA057757) at Atlas Antibodies

Documents & Links for Anti BMP7 pAb (ATL-HPA057757)
Datasheet Anti BMP7 pAb (ATL-HPA057757) Datasheet (External Link)
Vendor Page Anti BMP7 pAb (ATL-HPA057757)