Anti BMP6 pAb (ATL-HPA062683)

Atlas Antibodies

Catalog No.:
ATL-HPA062683-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: bone morphogenetic protein 6
Gene Name: BMP6
Alternative Gene Name: VGR, VGR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039004: 89%, ENSRNOG00000013717: 95%
Entrez Gene ID: 654
Uniprot ID: P22004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY
Gene Sequence FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY
Gene ID - Mouse ENSMUSG00000039004
Gene ID - Rat ENSRNOG00000013717
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BMP6 pAb (ATL-HPA062683)
Datasheet Anti BMP6 pAb (ATL-HPA062683) Datasheet (External Link)
Vendor Page Anti BMP6 pAb (ATL-HPA062683) at Atlas Antibodies

Documents & Links for Anti BMP6 pAb (ATL-HPA062683)
Datasheet Anti BMP6 pAb (ATL-HPA062683) Datasheet (External Link)
Vendor Page Anti BMP6 pAb (ATL-HPA062683)