Anti BMP6 pAb (ATL-HPA062683)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062683-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: BMP6
Alternative Gene Name: VGR, VGR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039004: 89%, ENSRNOG00000013717: 95%
Entrez Gene ID: 654
Uniprot ID: P22004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY |
| Gene Sequence | FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY |
| Gene ID - Mouse | ENSMUSG00000039004 |
| Gene ID - Rat | ENSRNOG00000013717 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BMP6 pAb (ATL-HPA062683) | |
| Datasheet | Anti BMP6 pAb (ATL-HPA062683) Datasheet (External Link) |
| Vendor Page | Anti BMP6 pAb (ATL-HPA062683) at Atlas Antibodies |
| Documents & Links for Anti BMP6 pAb (ATL-HPA062683) | |
| Datasheet | Anti BMP6 pAb (ATL-HPA062683) Datasheet (External Link) |
| Vendor Page | Anti BMP6 pAb (ATL-HPA062683) |