Anti BMP2K pAb (ATL-HPA026501)

Atlas Antibodies

Catalog No.:
ATL-HPA026501-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: BMP2 inducible kinase
Gene Name: BMP2K
Alternative Gene Name: BIKe, DKFZp434K0614
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034663: 80%, ENSRNOG00000002040: 78%
Entrez Gene ID: 55589
Uniprot ID: Q9NSY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRSNRLEERASSDKNVDSLSAPHNH
Gene Sequence YSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRSNRLEERASSDKNVDSLSAPHNH
Gene ID - Mouse ENSMUSG00000034663
Gene ID - Rat ENSRNOG00000002040
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BMP2K pAb (ATL-HPA026501)
Datasheet Anti BMP2K pAb (ATL-HPA026501) Datasheet (External Link)
Vendor Page Anti BMP2K pAb (ATL-HPA026501) at Atlas Antibodies

Documents & Links for Anti BMP2K pAb (ATL-HPA026501)
Datasheet Anti BMP2K pAb (ATL-HPA026501) Datasheet (External Link)
Vendor Page Anti BMP2K pAb (ATL-HPA026501)