Anti BMP2K pAb (ATL-HPA026501)
Atlas Antibodies
- SKU:
- ATL-HPA026501-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BMP2K
Alternative Gene Name: BIKe, DKFZp434K0614
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034663: 80%, ENSRNOG00000002040: 78%
Entrez Gene ID: 55589
Uniprot ID: Q9NSY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRSNRLEERASSDKNVDSLSAPHNH |
Gene Sequence | YSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRSNRLEERASSDKNVDSLSAPHNH |
Gene ID - Mouse | ENSMUSG00000034663 |
Gene ID - Rat | ENSRNOG00000002040 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BMP2K pAb (ATL-HPA026501) | |
Datasheet | Anti BMP2K pAb (ATL-HPA026501) Datasheet (External Link) |
Vendor Page | Anti BMP2K pAb (ATL-HPA026501) at Atlas Antibodies |
Documents & Links for Anti BMP2K pAb (ATL-HPA026501) | |
Datasheet | Anti BMP2K pAb (ATL-HPA026501) Datasheet (External Link) |
Vendor Page | Anti BMP2K pAb (ATL-HPA026501) |