Anti BMP2 pAb (ATL-HPA058610)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058610-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: BMP2
Alternative Gene Name: BMP2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027358: 89%, ENSRNOG00000021276: 91%
Entrez Gene ID: 650
Uniprot ID: P12643
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS |
Gene Sequence | RLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVSKRHVRIS |
Gene ID - Mouse | ENSMUSG00000027358 |
Gene ID - Rat | ENSRNOG00000021276 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BMP2 pAb (ATL-HPA058610) | |
Datasheet | Anti BMP2 pAb (ATL-HPA058610) Datasheet (External Link) |
Vendor Page | Anti BMP2 pAb (ATL-HPA058610) at Atlas Antibodies |
Documents & Links for Anti BMP2 pAb (ATL-HPA058610) | |
Datasheet | Anti BMP2 pAb (ATL-HPA058610) Datasheet (External Link) |
Vendor Page | Anti BMP2 pAb (ATL-HPA058610) |