Anti BMP1 pAb (ATL-HPA014572 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA014572-25

Protein Description: bone morphogenetic protein 1
Gene Name: BMP1
Alternative Gene Name: PCOLC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022098: 80%, ENSRNOG00000010890: 80%
Entrez Gene ID: 649
Uniprot ID: P13497
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGS
• Gene Sequence: DSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGS
• Gene ID - Mouse: ENSMUSG00000022098
• Gene ID - Rat: ENSRNOG00000010890
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BMP1 pAb (ATL-HPA014572 w/enhanced validation) – 2 Found

Hsieh, Yung-Yu; Tung, Shui-Yi; Pan, Hung-Yu; Yen, Chih-Wei; Xu, Huang-Wei; Deng, Yi-Fang; Lin, Ying-Jhen; Hsu, Wan-Ting; Wu, Cheng-Shyong; Li, Chin. Upregulation of bone morphogenetic protein 1 is associated with poor prognosis of late-stage gastric Cancer patients. Bmc Cancer. 2018;18(1):508. 

Vojtusek, Ivana Kovacevic; Laganovic, Mario; Burek Kamenaric, Marija; Bulimbasic, Stela; Hrkac, Stela; Salai, Grgur; Ivkovic, Vanja; Coric, Marijana; Novak, Rudjer; Grgurevic, Lovorka. First Characterization of ADAMTS-4 in Kidney Tissue and Plasma of Patients with Chronic Kidney Disease-A Potential Novel Diagnostic Indicator. Diagnostics (Basel, Switzerland). 2022;12(3)