Anti BMI1 pAb (ATL-HPA030471)

Atlas Antibodies

SKU: ATL-HPA030471-25

• 

Protein Description: BMI1 proto-oncogene, polycomb ring finger
Gene Name: BMI1
Alternative Gene Name: PCGF4, RNF51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026739: 94%, ENSRNOG00000016585: 86%
Entrez Gene ID: 648
Uniprot ID: P35226
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE
• Gene Sequence: SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE
• Gene ID - Mouse: ENSMUSG00000026739
• Gene ID - Rat: ENSRNOG00000016585
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.