Anti BMF pAb (ATL-HPA010120 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA010120-100
  • Immunohistochemical staining of human bone marrow shows moderate cytoplasmic positivity in megakaryocytes.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and BMF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY424040).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: Bcl2 modifying factor
Gene Name: BMF
Alternative Gene Name: FLJ00065
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040093: 91%, ENSRNOG00000007529: 92%
Entrez Gene ID: 90427
Uniprot ID: Q96LC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQ
Gene Sequence VEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQ
Gene ID - Mouse ENSMUSG00000040093
Gene ID - Rat ENSRNOG00000007529
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BMF pAb (ATL-HPA010120 w/enhanced validation)
Datasheet Anti BMF pAb (ATL-HPA010120 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BMF pAb (ATL-HPA010120 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BMF pAb (ATL-HPA010120 w/enhanced validation)
Datasheet Anti BMF pAb (ATL-HPA010120 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BMF pAb (ATL-HPA010120 w/enhanced validation)



Citations for Anti BMF pAb (ATL-HPA010120 w/enhanced validation) – 1 Found
Holzerland, Julia; Fénéant, Lucie; Banadyga, Logan; Hölper, Julia E; Knittler, Michael R; Groseth, Allison. BH3-only sensors Bad, Noxa and Puma are Key Regulators of Tacaribe virus-induced Apoptosis. Plos Pathogens. 2020;16(10):e1008948.  PubMed