Anti BLZF1 pAb (ATL-HPA067113)

Atlas Antibodies

Catalog No.:
ATL-HPA067113-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: basic leucine zipper nuclear factor 1
Gene Name: BLZF1
Alternative Gene Name: JEM-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026577: 90%, ENSRNOG00000002884: 80%
Entrez Gene ID: 8548
Uniprot ID: Q9H2G9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL
Gene Sequence IPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL
Gene ID - Mouse ENSMUSG00000026577
Gene ID - Rat ENSRNOG00000002884
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BLZF1 pAb (ATL-HPA067113)
Datasheet Anti BLZF1 pAb (ATL-HPA067113) Datasheet (External Link)
Vendor Page Anti BLZF1 pAb (ATL-HPA067113) at Atlas Antibodies

Documents & Links for Anti BLZF1 pAb (ATL-HPA067113)
Datasheet Anti BLZF1 pAb (ATL-HPA067113) Datasheet (External Link)
Vendor Page Anti BLZF1 pAb (ATL-HPA067113)