Anti BLZF1 pAb (ATL-HPA067113)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067113-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BLZF1
Alternative Gene Name: JEM-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026577: 90%, ENSRNOG00000002884: 80%
Entrez Gene ID: 8548
Uniprot ID: Q9H2G9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL |
Gene Sequence | IPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL |
Gene ID - Mouse | ENSMUSG00000026577 |
Gene ID - Rat | ENSRNOG00000002884 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BLZF1 pAb (ATL-HPA067113) | |
Datasheet | Anti BLZF1 pAb (ATL-HPA067113) Datasheet (External Link) |
Vendor Page | Anti BLZF1 pAb (ATL-HPA067113) at Atlas Antibodies |
Documents & Links for Anti BLZF1 pAb (ATL-HPA067113) | |
Datasheet | Anti BLZF1 pAb (ATL-HPA067113) Datasheet (External Link) |
Vendor Page | Anti BLZF1 pAb (ATL-HPA067113) |