Anti BLZF1 pAb (ATL-HPA027331)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027331-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BLZF1
Alternative Gene Name: JEM-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026577: 69%, ENSRNOG00000002884: 72%
Entrez Gene ID: 8548
Uniprot ID: Q9H2G9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVRSRKHHSLQSPWKKAVPSESPGVLQLGKMLTEKAMEVKAVRI |
Gene Sequence | ETKVTVTSSPIRGAGDGMETEEPPKSVEVTSGVRSRKHHSLQSPWKKAVPSESPGVLQLGKMLTEKAMEVKAVRI |
Gene ID - Mouse | ENSMUSG00000026577 |
Gene ID - Rat | ENSRNOG00000002884 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BLZF1 pAb (ATL-HPA027331) | |
Datasheet | Anti BLZF1 pAb (ATL-HPA027331) Datasheet (External Link) |
Vendor Page | Anti BLZF1 pAb (ATL-HPA027331) at Atlas Antibodies |
Documents & Links for Anti BLZF1 pAb (ATL-HPA027331) | |
Datasheet | Anti BLZF1 pAb (ATL-HPA027331) Datasheet (External Link) |
Vendor Page | Anti BLZF1 pAb (ATL-HPA027331) |