Anti BLZF1 pAb (ATL-HPA025703 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA025703-100

• 
• 

Protein Description: basic leucine zipper nuclear factor 1
Gene Name: BLZF1
Alternative Gene Name: JEM-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026577: 85%, ENSRNOG00000002884: 87%
Entrez Gene ID: 8548
Uniprot ID: Q9H2G9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLARE
• Gene Sequence: KSLGHHKGEFLGQSEGVIEPNKELSEVKNVLEKLKNSERRLLQDKEGLSNQLRVQTEVNRELKKLLVASVGDDLQYHFERLARE
• Gene ID - Mouse: ENSMUSG00000026577
• Gene ID - Rat: ENSRNOG00000002884
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.