Anti BLVRB pAb (ATL-HPA041937 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041937-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: BLVRB
Alternative Gene Name: FLR, SDR43U1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040466: 93%, ENSRNOG00000024410: 95%
Entrez Gene ID: 645
Uniprot ID: P30043
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DVDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDH |
| Gene Sequence | DVDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDH |
| Gene ID - Mouse | ENSMUSG00000040466 |
| Gene ID - Rat | ENSRNOG00000024410 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BLVRB pAb (ATL-HPA041937 w/enhanced validation) | |
| Datasheet | Anti BLVRB pAb (ATL-HPA041937 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BLVRB pAb (ATL-HPA041937 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BLVRB pAb (ATL-HPA041937 w/enhanced validation) | |
| Datasheet | Anti BLVRB pAb (ATL-HPA041937 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BLVRB pAb (ATL-HPA041937 w/enhanced validation) |
| Citations for Anti BLVRB pAb (ATL-HPA041937 w/enhanced validation) – 2 Found |
| Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |
| Matic, Ljubica Perisic; Jesus Iglesias, Maria; Vesterlund, Mattias; Lengquist, Mariette; Hong, Mun-Gwan; Saieed, Shanga; Sanchez-Rivera, Laura; Berg, Martin; Razuvaev, Anton; Kronqvist, Malin; Lund, Kent; Caidahl, Kenneth; Gillgren, Peter; Pontén, Fredrik; Uhlén, Mathias; Schwenk, Jochen M; Hansson, Göran K; Paulsson-Berne, Gabrielle; Fagman, Erika; Roy, Joy; Hultgren, Rebecka; Bergström, Göran; Lehtiö, Janne; Odeberg, Jacob; Hedin, Ulf. Novel Multiomics Profiling of Human Carotid Atherosclerotic Plaques and Plasma Reveals Biliverdin Reductase B as a Marker of Intraplaque Hemorrhage. Jacc. Basic To Translational Science. 2018;3(4):464-480. PubMed |