Anti BLVRA pAb (ATL-HPA054322)

Atlas Antibodies

Catalog No.:
ATL-HPA054322-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: biliverdin reductase A
Gene Name: BLVRA
Alternative Gene Name: BLVR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001999: 76%, ENSRNOG00000011778: 75%
Entrez Gene ID: 644
Uniprot ID: P53004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Gene Sequence EKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Gene ID - Mouse ENSMUSG00000001999
Gene ID - Rat ENSRNOG00000011778
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BLVRA pAb (ATL-HPA054322)
Datasheet Anti BLVRA pAb (ATL-HPA054322) Datasheet (External Link)
Vendor Page Anti BLVRA pAb (ATL-HPA054322) at Atlas Antibodies

Documents & Links for Anti BLVRA pAb (ATL-HPA054322)
Datasheet Anti BLVRA pAb (ATL-HPA054322) Datasheet (External Link)
Vendor Page Anti BLVRA pAb (ATL-HPA054322)