Anti BLVRA pAb (ATL-HPA019709)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019709-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BLVRA
Alternative Gene Name: BLVR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001999: 86%, ENSRNOG00000011778: 85%
Entrez Gene ID: 644
Uniprot ID: P53004
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVL |
Gene Sequence | EPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVL |
Gene ID - Mouse | ENSMUSG00000001999 |
Gene ID - Rat | ENSRNOG00000011778 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BLVRA pAb (ATL-HPA019709) | |
Datasheet | Anti BLVRA pAb (ATL-HPA019709) Datasheet (External Link) |
Vendor Page | Anti BLVRA pAb (ATL-HPA019709) at Atlas Antibodies |
Documents & Links for Anti BLVRA pAb (ATL-HPA019709) | |
Datasheet | Anti BLVRA pAb (ATL-HPA019709) Datasheet (External Link) |
Vendor Page | Anti BLVRA pAb (ATL-HPA019709) |