Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA039928-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: biogenesis of lysosomal organelles complex-1, subunit 6, pallidin
Gene Name: BLOC1S6
Alternative Gene Name: HPS9, PA, PLDN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005804: 91%, ENSRNOG00000037160: 90%
Entrez Gene ID: 26258
Uniprot ID: Q9UL45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM
Gene Sequence FAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM
Gene ID - Mouse ENSMUSG00000005804
Gene ID - Rat ENSRNOG00000037160
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation)
Datasheet Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation)
Datasheet Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation)