Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039928-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BLOC1S6
Alternative Gene Name: HPS9, PA, PLDN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005804: 91%, ENSRNOG00000037160: 90%
Entrez Gene ID: 26258
Uniprot ID: Q9UL45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM |
| Gene Sequence | FAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM |
| Gene ID - Mouse | ENSMUSG00000005804 |
| Gene ID - Rat | ENSRNOG00000037160 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation) | |
| Datasheet | Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation) | |
| Datasheet | Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BLOC1S6 pAb (ATL-HPA039928 w/enhanced validation) |