Anti BLOC1S4 pAb (ATL-HPA043840)

Atlas Antibodies

SKU: ATL-HPA043840-25

• 
• 

Protein Description: biogenesis of lysosomal organelles complex-1, subunit 4, cappuccino
Gene Name: BLOC1S4
Alternative Gene Name: BCAS4L, CNO, FLJ11230
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060708: 85%, ENSRNOG00000054224: 87%
Entrez Gene ID: 55330
Uniprot ID: Q9NUP1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YAACLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSR
• Gene Sequence: YAACLLPGAGARPEVEALDASLEDLLTRVDEFVGMLDMLRGDSSHVVSEGVPRIHAKAAEMRRIYSR
• Gene ID - Mouse: ENSMUSG00000060708
• Gene ID - Rat: ENSRNOG00000054224
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.