Anti BLOC1S2 pAb (ATL-HPA055010)

Atlas Antibodies

Catalog No.:
ATL-HPA055010-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: biogenesis of lysosomal organelles complex-1, subunit 2
Gene Name: BLOC1S2
Alternative Gene Name: BLOS2, FLJ30135, MGC10120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057506: 94%, ENSRNOG00000012684: 100%
Entrez Gene ID: 282991
Uniprot ID: Q6QNY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGLQPYLDQINVIEEQVAALEQAAYKLDAYS
Gene Sequence AGLQPYLDQINVIEEQVAALEQAAYKLDAYS
Gene ID - Mouse ENSMUSG00000057506
Gene ID - Rat ENSRNOG00000012684
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BLOC1S2 pAb (ATL-HPA055010)
Datasheet Anti BLOC1S2 pAb (ATL-HPA055010) Datasheet (External Link)
Vendor Page Anti BLOC1S2 pAb (ATL-HPA055010) at Atlas Antibodies

Documents & Links for Anti BLOC1S2 pAb (ATL-HPA055010)
Datasheet Anti BLOC1S2 pAb (ATL-HPA055010) Datasheet (External Link)
Vendor Page Anti BLOC1S2 pAb (ATL-HPA055010)