Anti BLOC1S2 pAb (ATL-HPA055010)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055010-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: BLOC1S2
Alternative Gene Name: BLOS2, FLJ30135, MGC10120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057506: 94%, ENSRNOG00000012684: 100%
Entrez Gene ID: 282991
Uniprot ID: Q6QNY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AGLQPYLDQINVIEEQVAALEQAAYKLDAYS |
Gene Sequence | AGLQPYLDQINVIEEQVAALEQAAYKLDAYS |
Gene ID - Mouse | ENSMUSG00000057506 |
Gene ID - Rat | ENSRNOG00000012684 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BLOC1S2 pAb (ATL-HPA055010) | |
Datasheet | Anti BLOC1S2 pAb (ATL-HPA055010) Datasheet (External Link) |
Vendor Page | Anti BLOC1S2 pAb (ATL-HPA055010) at Atlas Antibodies |
Documents & Links for Anti BLOC1S2 pAb (ATL-HPA055010) | |
Datasheet | Anti BLOC1S2 pAb (ATL-HPA055010) Datasheet (External Link) |
Vendor Page | Anti BLOC1S2 pAb (ATL-HPA055010) |