Anti BLOC1S1 pAb (ATL-HPA021381)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021381-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: BLOC1S1
Alternative Gene Name: BLOS1, GCN5L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090247: 99%, ENSRNOG00000007784: 100%
Entrez Gene ID: 2647
Uniprot ID: P78537
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ |
Gene Sequence | LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ |
Gene ID - Mouse | ENSMUSG00000090247 |
Gene ID - Rat | ENSRNOG00000007784 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BLOC1S1 pAb (ATL-HPA021381) | |
Datasheet | Anti BLOC1S1 pAb (ATL-HPA021381) Datasheet (External Link) |
Vendor Page | Anti BLOC1S1 pAb (ATL-HPA021381) at Atlas Antibodies |
Documents & Links for Anti BLOC1S1 pAb (ATL-HPA021381) | |
Datasheet | Anti BLOC1S1 pAb (ATL-HPA021381) Datasheet (External Link) |
Vendor Page | Anti BLOC1S1 pAb (ATL-HPA021381) |