Anti BLOC1S1 pAb (ATL-HPA021381)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021381-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: BLOC1S1
Alternative Gene Name: BLOS1, GCN5L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090247: 99%, ENSRNOG00000007784: 100%
Entrez Gene ID: 2647
Uniprot ID: P78537
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ |
| Gene Sequence | LLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQVQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQ |
| Gene ID - Mouse | ENSMUSG00000090247 |
| Gene ID - Rat | ENSRNOG00000007784 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BLOC1S1 pAb (ATL-HPA021381) | |
| Datasheet | Anti BLOC1S1 pAb (ATL-HPA021381) Datasheet (External Link) |
| Vendor Page | Anti BLOC1S1 pAb (ATL-HPA021381) at Atlas Antibodies |
| Documents & Links for Anti BLOC1S1 pAb (ATL-HPA021381) | |
| Datasheet | Anti BLOC1S1 pAb (ATL-HPA021381) Datasheet (External Link) |
| Vendor Page | Anti BLOC1S1 pAb (ATL-HPA021381) |