Anti BLNK pAb (ATL-HPA038310 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038310-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: BLNK
Alternative Gene Name: BASH, bca, BLNK-s, Ly57, SLP-65, SLP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061132: 90%, ENSRNOG00000013967: 88%
Entrez Gene ID: 29760
Uniprot ID: Q8WV28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSS |
Gene Sequence | HSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSS |
Gene ID - Mouse | ENSMUSG00000061132 |
Gene ID - Rat | ENSRNOG00000013967 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BLNK pAb (ATL-HPA038310 w/enhanced validation) | |
Datasheet | Anti BLNK pAb (ATL-HPA038310 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BLNK pAb (ATL-HPA038310 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti BLNK pAb (ATL-HPA038310 w/enhanced validation) | |
Datasheet | Anti BLNK pAb (ATL-HPA038310 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti BLNK pAb (ATL-HPA038310 w/enhanced validation) |