Anti BLNK pAb (ATL-HPA038309 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038309-25

• 
• 
• 

Protein Description: B-cell linker
Gene Name: BLNK
Alternative Gene Name: BASH, bca, BLNK-s, Ly57, SLP-65, SLP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061132: 89%, ENSRNOG00000013967: 88%
Entrez Gene ID: 29760
Uniprot ID: Q8WV28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALP
• Gene Sequence: EGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALP
• Gene ID - Mouse: ENSMUSG00000061132
• Gene ID - Rat: ENSRNOG00000013967
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.