Anti BLNK pAb (ATL-HPA038309 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA038309-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: B-cell linker
Gene Name: BLNK
Alternative Gene Name: BASH, bca, BLNK-s, Ly57, SLP-65, SLP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061132: 89%, ENSRNOG00000013967: 88%
Entrez Gene ID: 29760
Uniprot ID: Q8WV28
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALP
Gene Sequence EGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALP
Gene ID - Mouse ENSMUSG00000061132
Gene ID - Rat ENSRNOG00000013967
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BLNK pAb (ATL-HPA038309 w/enhanced validation)
Datasheet Anti BLNK pAb (ATL-HPA038309 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BLNK pAb (ATL-HPA038309 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BLNK pAb (ATL-HPA038309 w/enhanced validation)
Datasheet Anti BLNK pAb (ATL-HPA038309 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BLNK pAb (ATL-HPA038309 w/enhanced validation)