Anti BLM pAb (ATL-HPA005689)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005689-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: BLM
Alternative Gene Name: BS, RECQ2, RECQL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030528: 64%, ENSRNOG00000011213: 64%
Entrez Gene ID: 641
Uniprot ID: P54132
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV |
Gene Sequence | STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV |
Gene ID - Mouse | ENSMUSG00000030528 |
Gene ID - Rat | ENSRNOG00000011213 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti BLM pAb (ATL-HPA005689) | |
Datasheet | Anti BLM pAb (ATL-HPA005689) Datasheet (External Link) |
Vendor Page | Anti BLM pAb (ATL-HPA005689) at Atlas Antibodies |
Documents & Links for Anti BLM pAb (ATL-HPA005689) | |
Datasheet | Anti BLM pAb (ATL-HPA005689) Datasheet (External Link) |
Vendor Page | Anti BLM pAb (ATL-HPA005689) |
Citations for Anti BLM pAb (ATL-HPA005689) – 5 Found |
Pal, Debjani; Pertot, Anja; Shirole, Nitin H; Yao, Zhan; Anaparthy, Naishitha; Garvin, Tyler; Cox, Hilary; Chang, Kenneth; Rollins, Fred; Kendall, Jude; Edwards, Leyla; Singh, Vijay A; Stone, Gary C; Schatz, Michael C; Hicks, James; Hannon, Gregory J; Sordella, Raffaella. TGF-β reduces DNA ds-break repair mechanisms to heighten genetic diversity and adaptability of CD44+/CD24- cancer cells. Elife. 2017;6( 28092266) PubMed |
Croft, Laura V; Ashton, Nicholas W; Paquet, Nicolas; Bolderson, Emma; O'Byrne, Kenneth J; Richard, Derek J. hSSB1 associates with and promotes stability of the BLM helicase. Bmc Molecular Biology. 2017;18(1):13. PubMed |
Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
Lao, Victoria Valinluck; Welcsh, Piri; Luo, Yanxin; Carter, Kelly T; Dzieciatkowski, Slavomir; Dintzis, Suzanne; Meza, Jane; Sarvetnick, Nora E; Monnat, Raymond J Jr; Loeb, Lawrence A; Grady, William M. Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers. Translational Oncology. 2013;6(4):458-69. PubMed |
Meena, Jitendra K; Cerutti, Aurora; Beichler, Christine; Morita, Yohei; Bruhn, Christopher; Kumar, Mukesh; Kraus, Johann M; Speicher, Michael R; Wang, Zhao-Qi; Kestler, Hans A; d'Adda di Fagagna, Fabrizio; Günes, Cagatay; Rudolph, Karl Lenhard. Telomerase abrogates aneuploidy-induced telomere replication stress, senescence and cell depletion. The Embo Journal. 2015;34(10):1371-84. PubMed |