Anti BLM pAb (ATL-HPA005689)

Atlas Antibodies

SKU: ATL-HPA005689-25

• 
• 

Protein Description: Bloom syndrome, RecQ helicase-like
Gene Name: BLM
Alternative Gene Name: BS, RECQ2, RECQL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030528: 64%, ENSRNOG00000011213: 64%
Entrez Gene ID: 641
Uniprot ID: P54132
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV
• Gene Sequence: STLKDLDTSDRKEDVLSTSKDLLSKPEKMSMQELNPETSTDCDARQISLQQQLIHVMEHICKLIDTIPDDKLKLLDCGNELLQQRNIRRKLLTEVDFNKSDASLLGSLWRYRPDSLDGPMEGDSCPTGNSMKELNFSHLPSNSV
• Gene ID - Mouse: ENSMUSG00000030528
• Gene ID - Rat: ENSRNOG00000011213
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BLM pAb (ATL-HPA005689) – 5 Found

Pal, Debjani; Pertot, Anja; Shirole, Nitin H; Yao, Zhan; Anaparthy, Naishitha; Garvin, Tyler; Cox, Hilary; Chang, Kenneth; Rollins, Fred; Kendall, Jude; Edwards, Leyla; Singh, Vijay A; Stone, Gary C; Schatz, Michael C; Hicks, James; Hannon, Gregory J; Sordella, Raffaella. TGF-β reduces DNA ds-break repair mechanisms to heighten genetic diversity and adaptability of CD44+/CD24- cancer cells. Elife. 2017;6( 28092266) 

Croft, Laura V; Ashton, Nicholas W; Paquet, Nicolas; Bolderson, Emma; O'Byrne, Kenneth J; Richard, Derek J. hSSB1 associates with and promotes stability of the BLM helicase. Bmc Molecular Biology. 2017;18(1):13. 

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Lao, Victoria Valinluck; Welcsh, Piri; Luo, Yanxin; Carter, Kelly T; Dzieciatkowski, Slavomir; Dintzis, Suzanne; Meza, Jane; Sarvetnick, Nora E; Monnat, Raymond J Jr; Loeb, Lawrence A; Grady, William M. Altered RECQ Helicase Expression in Sporadic Primary Colorectal Cancers. Translational Oncology. 2013;6(4):458-69. 

Meena, Jitendra K; Cerutti, Aurora; Beichler, Christine; Morita, Yohei; Bruhn, Christopher; Kumar, Mukesh; Kraus, Johann M; Speicher, Michael R; Wang, Zhao-Qi; Kestler, Hans A; d'Adda di Fagagna, Fabrizio; Günes, Cagatay; Rudolph, Karl Lenhard. Telomerase abrogates aneuploidy-induced telomere replication stress, senescence and cell depletion. The Embo Journal. 2015;34(10):1371-84.