Anti BLK pAb (ATL-HPA069571)

Atlas Antibodies

Catalog No.: ATL-HPA069571-25

Protein Description: BLK proto-oncogene, Src family tyrosine kinase
Gene Name: BLK
Alternative Gene Name: MGC10442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014453: 84%, ENSRNOG00000010798: 86%
Entrez Gene ID: 640
Uniprot ID: P51451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWF
• Gene Sequence: YTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWF
• Gene ID - Mouse: ENSMUSG00000014453
• Gene ID - Rat: ENSRNOG00000010798
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.