Anti BLK pAb (ATL-HPA069571)

Atlas Antibodies

SKU:
ATL-HPA069571-25
  • Immunofluorescent staining of human cell line REH shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: BLK proto-oncogene, Src family tyrosine kinase
Gene Name: BLK
Alternative Gene Name: MGC10442
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014453: 84%, ENSRNOG00000010798: 86%
Entrez Gene ID: 640
Uniprot ID: P51451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWF
Gene Sequence YTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWF
Gene ID - Mouse ENSMUSG00000014453
Gene ID - Rat ENSRNOG00000010798
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BLK pAb (ATL-HPA069571)
Datasheet Anti BLK pAb (ATL-HPA069571) Datasheet (External Link)
Vendor Page Anti BLK pAb (ATL-HPA069571) at Atlas Antibodies

Documents & Links for Anti BLK pAb (ATL-HPA069571)
Datasheet Anti BLK pAb (ATL-HPA069571) Datasheet (External Link)
Vendor Page Anti BLK pAb (ATL-HPA069571)