Anti BLACE pAb (ATL-HPA041918)

Atlas Antibodies

SKU:
ATL-HPA041918-25
  • Immunohistochemical staining of human gall bladder shows distinct cytoplasmic and membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: B-cell acute lymphoblastic leukemia expressed
Gene Name: BLACE
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078776: 21%, ENSRNOG00000013364: 23%
Entrez Gene ID:
Uniprot ID: A4D250
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HAWLYLTRHFPWSPFPHGGWTDTSEPCVLETLGGSSLAALWGNSLWVQSSGACAFCVYESLIEQSLPNERFEELLLGPSPGEVM
Gene Sequence HAWLYLTRHFPWSPFPHGGWTDTSEPCVLETLGGSSLAALWGNSLWVQSSGACAFCVYESLIEQSLPNERFEELLLGPSPGEVM
Gene ID - Mouse ENSMUSG00000078776
Gene ID - Rat ENSRNOG00000013364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BLACE pAb (ATL-HPA041918)
Datasheet Anti BLACE pAb (ATL-HPA041918) Datasheet (External Link)
Vendor Page Anti BLACE pAb (ATL-HPA041918) at Atlas Antibodies

Documents & Links for Anti BLACE pAb (ATL-HPA041918)
Datasheet Anti BLACE pAb (ATL-HPA041918) Datasheet (External Link)
Vendor Page Anti BLACE pAb (ATL-HPA041918)