Anti BIVM pAb (ATL-HPA050126)

Atlas Antibodies

Catalog No.:
ATL-HPA050126-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: basic, immunoglobulin-like variable motif containing
Gene Name: BIVM
Alternative Gene Name: FLJ20159
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041684: 76%, ENSRNOG00000022894: 75%
Entrez Gene ID: 54841
Uniprot ID: Q86UB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSNDSGNGEHKSERKSPEENLQGAVKSFCTSASGAPLGPKGDGHYPWSCPVTHTREKIYAICSDYAFLNQATSIYKTPNPSRSPCLPDSTSLSAGNNSSRY
Gene Sequence RSNDSGNGEHKSERKSPEENLQGAVKSFCTSASGAPLGPKGDGHYPWSCPVTHTREKIYAICSDYAFLNQATSIYKTPNPSRSPCLPDSTSLSAGNNSSRY
Gene ID - Mouse ENSMUSG00000041684
Gene ID - Rat ENSRNOG00000022894
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BIVM pAb (ATL-HPA050126)
Datasheet Anti BIVM pAb (ATL-HPA050126) Datasheet (External Link)
Vendor Page Anti BIVM pAb (ATL-HPA050126) at Atlas Antibodies

Documents & Links for Anti BIVM pAb (ATL-HPA050126)
Datasheet Anti BIVM pAb (ATL-HPA050126) Datasheet (External Link)
Vendor Page Anti BIVM pAb (ATL-HPA050126)