Anti BIRC7 pAb (ATL-HPA047850)

Atlas Antibodies

Catalog No.: ATL-HPA047850-25

Protein Description: baculoviral IAP repeat containing 7
Gene Name: BIRC7
Alternative Gene Name: KIAP, ML-IAP, mliap, RNF50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038840: 51%, ENSRNOG00000043311: 48%
Entrez Gene ID: 79444
Uniprot ID: Q96CA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE
• Gene Sequence: MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE
• Gene ID - Mouse: ENSMUSG00000038840
• Gene ID - Rat: ENSRNOG00000043311
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.