Anti BIRC7 pAb (ATL-HPA047850)

Atlas Antibodies

Catalog No.:
ATL-HPA047850-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: baculoviral IAP repeat containing 7
Gene Name: BIRC7
Alternative Gene Name: KIAP, ML-IAP, mliap, RNF50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038840: 51%, ENSRNOG00000043311: 48%
Entrez Gene ID: 79444
Uniprot ID: Q96CA5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE
Gene Sequence MGPKDSAKCLHRGPQPSHWAAGDGPTQERCGPRSLGSPVLGLDTCRAWDHVDGQILGQLRPLTEEEE
Gene ID - Mouse ENSMUSG00000038840
Gene ID - Rat ENSRNOG00000043311
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BIRC7 pAb (ATL-HPA047850)
Datasheet Anti BIRC7 pAb (ATL-HPA047850) Datasheet (External Link)
Vendor Page Anti BIRC7 pAb (ATL-HPA047850) at Atlas Antibodies

Documents & Links for Anti BIRC7 pAb (ATL-HPA047850)
Datasheet Anti BIRC7 pAb (ATL-HPA047850) Datasheet (External Link)
Vendor Page Anti BIRC7 pAb (ATL-HPA047850)