Anti BIRC6 pAb (ATL-HPA074738)

Atlas Antibodies

Catalog No.: ATL-HPA074738-25

Protein Description: baculoviral IAP repeat containing 6
Gene Name: BIRC6
Alternative Gene Name: BRUCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024073: 99%, ENSRNOG00000027191: 99%
Entrez Gene ID: 57448
Uniprot ID: Q9NR09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAA
• Gene Sequence: GSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAA
• Gene ID - Mouse: ENSMUSG00000024073
• Gene ID - Rat: ENSRNOG00000027191
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.