Anti BIRC6 pAb (ATL-HPA074738)

Atlas Antibodies

Catalog No.:
ATL-HPA074738-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: baculoviral IAP repeat containing 6
Gene Name: BIRC6
Alternative Gene Name: BRUCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024073: 99%, ENSRNOG00000027191: 99%
Entrez Gene ID: 57448
Uniprot ID: Q9NR09
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAA
Gene Sequence GSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAA
Gene ID - Mouse ENSMUSG00000024073
Gene ID - Rat ENSRNOG00000027191
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BIRC6 pAb (ATL-HPA074738)
Datasheet Anti BIRC6 pAb (ATL-HPA074738) Datasheet (External Link)
Vendor Page Anti BIRC6 pAb (ATL-HPA074738) at Atlas Antibodies

Documents & Links for Anti BIRC6 pAb (ATL-HPA074738)
Datasheet Anti BIRC6 pAb (ATL-HPA074738) Datasheet (External Link)
Vendor Page Anti BIRC6 pAb (ATL-HPA074738)