Anti BIRC5 pAb (ATL-HPA002830 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA002830-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: BIRC5
Alternative Gene Name: API4, EPR-1, survivin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017716: 86%, ENSRNOG00000050819: 88%
Entrez Gene ID: 332
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA |
| Gene Sequence | MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA |
| Gene ID - Mouse | ENSMUSG00000017716 |
| Gene ID - Rat | ENSRNOG00000050819 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BIRC5 pAb (ATL-HPA002830 w/enhanced validation) | |
| Datasheet | Anti BIRC5 pAb (ATL-HPA002830 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BIRC5 pAb (ATL-HPA002830 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti BIRC5 pAb (ATL-HPA002830 w/enhanced validation) | |
| Datasheet | Anti BIRC5 pAb (ATL-HPA002830 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti BIRC5 pAb (ATL-HPA002830 w/enhanced validation) |
| Citations for Anti BIRC5 pAb (ATL-HPA002830 w/enhanced validation) – 2 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Lin, Peng; He, Rong-Quan; Dang, Yi-Wu; Wen, Dong-Yue; Ma, Jie; He, Yun; Chen, Gang; Yang, Hong. An autophagy-related gene expression signature for survival prediction in multiple cohorts of hepatocellular carcinoma patients. Oncotarget. 2018;9(25):17368-17395. PubMed |