Anti BIRC5 pAb (ATL-HPA002830 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002830-25

Protein Description: baculoviral IAP repeat containing 5
Gene Name: BIRC5
Alternative Gene Name: API4, EPR-1, survivin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017716: 86%, ENSRNOG00000050819: 88%
Entrez Gene ID: 332
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA
• Gene Sequence: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETA
• Gene ID - Mouse: ENSMUSG00000017716
• Gene ID - Rat: ENSRNOG00000050819
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BIRC5 pAb (ATL-HPA002830 w/enhanced validation) – 2 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Lin, Peng; He, Rong-Quan; Dang, Yi-Wu; Wen, Dong-Yue; Ma, Jie; He, Yun; Chen, Gang; Yang, Hong. An autophagy-related gene expression signature for survival prediction in multiple cohorts of hepatocellular carcinoma patients. Oncotarget. 2018;9(25):17368-17395.