Anti BIRC2 pAb (ATL-HPA005513)

Atlas Antibodies

Catalog No.: ATL-HPA005513-25

Protein Description: baculoviral IAP repeat containing 2
Gene Name: BIRC2
Alternative Gene Name: API1, c-IAP1, cIAP1, hiap-2, MIHB, RNF48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057367: 69%, ENSRNOG00000010602: 66%
Entrez Gene ID: 329
Uniprot ID: Q13490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF
• Gene Sequence: NWKLGDSPIQKHKQLYPSCSFIQNLVSASLGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPLTFLSPSELARAGF
• Gene ID - Mouse: ENSMUSG00000057367
• Gene ID - Rat: ENSRNOG00000010602
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BIRC2 pAb (ATL-HPA005513) – 1 Found

Bagnjuk, Konstantin; Kast, Verena Jasmin; Tiefenbacher, Astrid; Kaseder, Melanie; Yanase, Toshihiko; Burges, Alexander; Kunz, Lars; Mayr, Doris; Mayerhofer, Artur. Inhibitor of apoptosis proteins are potential targets for treatment of granulosa cell tumors - implications from studies in KGN. Journal Of Ovarian Research. 2019;12(1):76.