Anti BIN3 pAb (ATL-HPA023769 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023769-100

Protein Description: bridging integrator 3
Gene Name: BIN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022089: 95%, ENSRNOG00000018023: 97%
Entrez Gene ID: 55909
Uniprot ID: Q9NQY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNPLCEQDQD
• Gene Sequence: PKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNPLCEQDQD
• Gene ID - Mouse: ENSMUSG00000022089
• Gene ID - Rat: ENSRNOG00000018023
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.