Anti BIN1 pAb (ATL-HPA003894 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA003894-25
  • Immunohistochemistry analysis in human skeletal muscle and heart muscle tissues using Anti-BIN1 antibody. Corresponding BIN1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Western blot analysis in human cell lines Caco-2 and MCF-7 using Anti-BIN1 antibody. Corresponding BIN1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: bridging integrator 1
Gene Name: BIN1
Alternative Gene Name: AMPH2, AMPHL, SH3P9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024381: 94%, ENSRNOG00000012852: 93%
Entrez Gene ID: 274
Uniprot ID: O00499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Gene Sequence SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Gene ID - Mouse ENSMUSG00000024381
Gene ID - Rat ENSRNOG00000012852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BIN1 pAb (ATL-HPA003894 w/enhanced validation)
Datasheet Anti BIN1 pAb (ATL-HPA003894 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BIN1 pAb (ATL-HPA003894 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BIN1 pAb (ATL-HPA003894 w/enhanced validation)
Datasheet Anti BIN1 pAb (ATL-HPA003894 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BIN1 pAb (ATL-HPA003894 w/enhanced validation)



Citations for Anti BIN1 pAb (ATL-HPA003894 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed