Anti BIK pAb (ATL-HPA051360)

Atlas Antibodies

Catalog No.:
ATL-HPA051360-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: BCL2-interacting killer (apoptosis-inducing)
Gene Name: BIK
Alternative Gene Name: NBK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020901: 33%, ENSRNOG00000023428: 33%
Entrez Gene ID: 638
Uniprot ID: Q13323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDAL
Gene Sequence LSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDAL
Gene ID - Mouse ENSMUSG00000020901
Gene ID - Rat ENSRNOG00000023428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti BIK pAb (ATL-HPA051360)
Datasheet Anti BIK pAb (ATL-HPA051360) Datasheet (External Link)
Vendor Page Anti BIK pAb (ATL-HPA051360) at Atlas Antibodies

Documents & Links for Anti BIK pAb (ATL-HPA051360)
Datasheet Anti BIK pAb (ATL-HPA051360) Datasheet (External Link)
Vendor Page Anti BIK pAb (ATL-HPA051360)