Anti BIK pAb (ATL-HPA051360)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051360-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: BIK
Alternative Gene Name: NBK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020901: 33%, ENSRNOG00000023428: 33%
Entrez Gene ID: 638
Uniprot ID: Q13323
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDAL |
| Gene Sequence | LSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDAL |
| Gene ID - Mouse | ENSMUSG00000020901 |
| Gene ID - Rat | ENSRNOG00000023428 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti BIK pAb (ATL-HPA051360) | |
| Datasheet | Anti BIK pAb (ATL-HPA051360) Datasheet (External Link) |
| Vendor Page | Anti BIK pAb (ATL-HPA051360) at Atlas Antibodies |
| Documents & Links for Anti BIK pAb (ATL-HPA051360) | |
| Datasheet | Anti BIK pAb (ATL-HPA051360) Datasheet (External Link) |
| Vendor Page | Anti BIK pAb (ATL-HPA051360) |