Anti BID pAb (ATL-HPA000722 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA000722-25
  • Immunohistochemistry analysis in human bone marrow and testis tissues using Anti-BID antibody. Corresponding BID RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Western blot analysis in human cell lines MCF-7 and HeLa using Anti-BID antibody. Corresponding BID RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: BH3 interacting domain death agonist
Gene Name: BID
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004446: 64%, ENSRNOG00000012439: 61%
Entrez Gene ID: 637
Uniprot ID: P55957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLAR
Gene Sequence VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLAR
Gene ID - Mouse ENSMUSG00000004446
Gene ID - Rat ENSRNOG00000012439
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti BID pAb (ATL-HPA000722 w/enhanced validation)
Datasheet Anti BID pAb (ATL-HPA000722 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BID pAb (ATL-HPA000722 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti BID pAb (ATL-HPA000722 w/enhanced validation)
Datasheet Anti BID pAb (ATL-HPA000722 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti BID pAb (ATL-HPA000722 w/enhanced validation)



Citations for Anti BID pAb (ATL-HPA000722 w/enhanced validation) – 3 Found
Spencer, Sabrina L; Gaudet, Suzanne; Albeck, John G; Burke, John M; Sorger, Peter K. Non-genetic origins of cell-to-cell variability in TRAIL-induced apoptosis. Nature. 2009;459(7245):428-32.  PubMed
Aldridge, Bree B; Gaudet, Suzanne; Lauffenburger, Douglas A; Sorger, Peter K. Lyapunov exponents and phase diagrams reveal multi-factorial control over TRAIL-induced apoptosis. Molecular Systems Biology. 2011;7( 22108795):553.  PubMed
Gaudet, Suzanne; Spencer, Sabrina L; Chen, William W; Sorger, Peter K. Exploring the contextual sensitivity of factors that determine cell-to-cell variability in receptor-mediated apoptosis. Plos Computational Biology. 8(4):e1002482.  PubMed
!