Anti BID pAb (ATL-HPA000722 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000722-25

Protein Description: BH3 interacting domain death agonist
Gene Name: BID
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004446: 64%, ENSRNOG00000012439: 61%
Entrez Gene ID: 637
Uniprot ID: P55957
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLAR
• Gene Sequence: VNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLAR
• Gene ID - Mouse: ENSMUSG00000004446
• Gene ID - Rat: ENSRNOG00000012439
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti BID pAb (ATL-HPA000722 w/enhanced validation) – 3 Found

Spencer, Sabrina L; Gaudet, Suzanne; Albeck, John G; Burke, John M; Sorger, Peter K. Non-genetic origins of cell-to-cell variability in TRAIL-induced apoptosis. Nature. 2009;459(7245):428-32. 

Aldridge, Bree B; Gaudet, Suzanne; Lauffenburger, Douglas A; Sorger, Peter K. Lyapunov exponents and phase diagrams reveal multi-factorial control over TRAIL-induced apoptosis. Molecular Systems Biology. 2011;7( 22108795):553. 

Gaudet, Suzanne; Spencer, Sabrina L; Chen, William W; Sorger, Peter K. Exploring the contextual sensitivity of factors that determine cell-to-cell variability in receptor-mediated apoptosis. Plos Computational Biology. 8(4):e1002482.